Proteintech, 29910-1-AP, RORC Polyclonal antibody

Size: 20ul / 150ul The RORC (29910-1-AP) by Proteintech is a Polyclonal antibody targeting RORC in WB, ELISA applications with reactivity to human, mouse, rat samples 29910-1-AP targets RORC in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse colon tissue, mouse liver tissue, mouse testis tissue, rat liver tissue, rat testis tissue, rat thymus tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information The Nuclear receptors retinoic acid receptor-related orphan receptor gamma (RORγ or RORc, also known as NR1F3) was the third and most recent ROR group member to be discovered, following the prior disclosures of RORα (RORa or NR1F1) and RORβ (RORb or NR1F2) (PMID:24502334). Studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2.RORC has 2 isoforms with the MW of 56 kDa and 58 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31783 Product name: Recombinant human RORC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 165-320 aa of BC031554 Sequence: DLPEASACPPGLLKASGSGPSYSNNLAKAGLNGASCHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPGLGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERC Predict reactive species Full Name: RAR-related orphan receptor C Calculated Molecular Weight: 518 aa, 58 kDa Observed Molecular Weight: 56 kDa GenBank Accession Number: BC031554 Gene Symbol: RORC Gene ID (NCBI): 6097 RRID: AB_2935489 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P51449 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.