Iright
BRAND / VENDOR: Proteintech

Proteintech, 29927-1-AP, RAB12 Polyclonal antibody

CATALOG NUMBER: 29927-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RAB12 (29927-1-AP) by Proteintech is a Polyclonal antibody targeting RAB12 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 29927-1-AP targets RAB12 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human brain tissue, mouse brain tissue, rat brain tissue Positive IP detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Rab12, a previously uncharacterized Rab isoform, is mainly localized at TfR-positive recycling endosomes and is specifically involved in TfR degradation. Rab12 is a regulator of LRRK2 and its activation by damaged lysosomes. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31627 Product name: Recombinant human RAB12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 105-244 aa of NM_001025300 Sequence: NSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKMPLDILRNELSNSILSLQPEPEIPPELPPPRPHVRCC Predict reactive species Full Name: RAB12, member RAS oncogene family Calculated Molecular Weight: 27KD Observed Molecular Weight: 27 kDa GenBank Accession Number: NM_001025300 Gene Symbol: RAB12 Gene ID (NCBI): 201475 RRID: AB_3669700 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6IQ22 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924