Iright
BRAND / VENDOR: Proteintech

Proteintech, 29930-1-AP, SPATS2L Polyclonal antibody

CATALOG NUMBER: 29930-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SPATS2L (29930-1-AP) by Proteintech is a Polyclonal antibody targeting SPATS2L in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, mouse, rat samples 29930-1-AP targets SPATS2L in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HepG2 cells, mouse kidney tissue, rat kidney tissue Positive IHC detected in: human lung cancer tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information SPATS2L encodes spermatogenesis associated and serine-rich 2-like protein, also named DNAPTP6 (DNA polymerase transactivated protein 6) in human (PMID:11230166). SPATS2L acts as an important regulator of β2-adrenergic receptor down-regulation (PubMed: 25562107). MiR-1269a down-regulates the expression of SPATS2L and LRP6, thereby inhibiting the proliferation of liver cancer cells (PMID: 28081866, PMID:35252180). SPATS2L has several isoforms by alternative splicing. Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31157 Product name: Recombinant human SPATS2L protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 290-488 aa of BC018736 Sequence: NYSSRTPCSSLLPLLNAHAATSGKQSNFSRKSSTHNKPSEGKAANPKMVSSLPSTADPSHQTMPANKQNGSSNQRRRFNPQYHNNRLNGPAKSQGSGNEAEPLGKGNSRHEHRRQPHNGFRPKNKGGAKNQEASLGMKTPEAPAHSEKPRRRQHAADTSEARPFRGSVGRVSQCNLCPTRIEVSTDAAVLSVPAVTLVA Predict reactive species Full Name: viral DNA polymerase-transactivated protein 6 Calculated Molecular Weight: 488 aa, 54 kDa Observed Molecular Weight: 54-65 kDa GenBank Accession Number: BC018736 Gene Symbol: SPATS2L Gene ID (NCBI): 26010 RRID: AB_2923620 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NUQ6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924