Proteintech, 29931-1-AP, SERPINA6/CBG Polyclonal antibody

Size: 20ul / 150ul The SERPINA6/CBG (29931-1-AP) by Proteintech is a Polyclonal antibody targeting SERPINA6/CBG in WB, IHC, IP, ELISA applications with reactivity to human samples 29931-1-AP targets SERPINA6/CBG in WB, IHC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma Positive IP detected in: human placenta tissue Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SERPINA6, also known as corticosteroid-binding globulin or CBG, belongs to the serpin family of serine protease inhibitors, and is mainly secreted by the liver. It is an alpha-globulin protein with corticosteroid-binding properties, and involved in obesity and stress sensitivity. It is also the major transport protein for glucorticoids and progestins in the blood of most vertebrates. Defects in SERPINA6 are a cause of corticosteroid-binding globulin deficiency (CBG deficiency). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31861 Product name: Recombinant human Corticosteroid binding globulin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 268-405 aa of BC058021 Sequence: PDKGKMNTVIAALSRDTINRWSAGLTSSQVDLYIPKVTISGVYDLGDVLEEMGIADLFTNQANFSRITQDAQLKSSKVVHKAVLQLNEEGVDTAGSTGVTLNLTSKPIILRFNQPFIIMIFDHFTWSSLFLARVMNPV Predict reactive species Full Name: serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 6 Calculated Molecular Weight: 405 aa, 45 kDa Observed Molecular Weight: 45-55 kDa GenBank Accession Number: BC058021 Gene Symbol: SERPINA6 Gene ID (NCBI): 866 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P08185 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.