Iright
BRAND / VENDOR: Proteintech

Proteintech, 29935-1-AP, EIF2B5 Polyclonal antibody

CATALOG NUMBER: 29935-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EIF2B5 (29935-1-AP) by Proteintech is a Polyclonal antibody targeting EIF2B5 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, mouse, rat samples 29935-1-AP targets EIF2B5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HEK-293T cells, HT-29 cells, HeLa cells, Jurkat cells, NIH/3T3 cells, mouse brain tissue, rat brain tissue Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information EIF2B5 encodes translation initiation factor eIF-2B subunit epsilon protein (PMID 8688466). EIF2B5 mutations compromise the induction of GFAP-expressing astrocytes in VWM (vanishing white matter) leukodystrophy (PMID:15723074, PMID:15776425). The upregulation of EIF2B5 is associated with cancer such as human pulmonary adenocarcinoma cell and breast cancer (PMID:24366584, PMID:24979338). EIF2B5 also has 65kDa truncated protein isoform (PMID:28961236). Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32175 Product name: Recombinant human EIF2B5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 455-711 aa of NM_003907.2 Sequence: DAEEDEDDGEFSDDSGADQEKDKVKMKGYNPAEVGAAGKGYLWKAAGMNMEEEEELQQNLWGLKINMEEESESESEQSMDSEEPDSRGGSPQMDDIKVFQNEVLGTLQRGKEENISCDNLVLEINSLKYAYNISLKEVMQVLSHVVLEFPLQQMDSPLDSSRYCALLLPLLKAWSPVFRNYIKRAADHLEALAAIEDFFLEHEALGISMAKVLMAFYQLEILAEETILSWFSQRDTTDKGQQLRKNQQLQRFIQWLK Predict reactive species Full Name: eukaryotic translation initiation factor 2B, subunit 5 epsilon, 82kDa Calculated Molecular Weight: 80 kDa Observed Molecular Weight: 65-80 kDa GenBank Accession Number: NM_003907.2 Gene Symbol: EIF2B5 Gene ID (NCBI): 8893 RRID: AB_2923623 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13144 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924