Iright
BRAND / VENDOR: Proteintech

Proteintech, 29938-1-AP, DOCK5 Polyclonal antibody

CATALOG NUMBER: 29938-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DOCK5 (29938-1-AP) by Proteintech is a Polyclonal antibody targeting DOCK5 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 29938-1-AP targets DOCK5 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: LNCaP cells, Jurkat cells, A549 cells, DU 145 cells, NIH3T3 cells, rat brain tissue, NIH/3T3 cells, mouse brain tissue Positive IP detected in: DU 145 cells Positive IHC detected in: mouse kidney tissue, human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information DOCK5 is a member of the dedicator of cytokinesis protein family. Members of this family act as guanine nucleotide exchange factors for small Rho family G proteins. DOCK5 is thought to associate with adaptors CRK and CRKL, and function in regulation of intestinal epithelial cell spreading and migration on collagen IV. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32193 Product name: Recombinant human DOCK5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1700-1870 aa of BC137175 Sequence: ILEPLLERRASSGARVEDLSLREENSENRISKFKRKDWSLSKSQVIAEKAPEPDLMSPTRKAQRPKSLQLMDNRLSPFHGSSPPQSTPLSPPPLTPKATRTLSSPSLQTDGIAATPVPPPPPPKSKPYEGSQRNSTELAPPLPVRREAKAPPPPPPKARKSGIPTSEPGSQ Predict reactive species Full Name: dedicator of cytokinesis 5 Calculated Molecular Weight: 1870 aa, 215 kDa Observed Molecular Weight: 190 kDa GenBank Accession Number: BC137175 Gene Symbol: DOCK5 Gene ID (NCBI): 80005 RRID: AB_3086194 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H7D0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924