Proteintech, 29941-1-AP, UNC5D Polyclonal antibody

Size: 20ul / 150ul The UNC5D (29941-1-AP) by Proteintech is a Polyclonal antibody targeting UNC5D in WB, ELISA applications with reactivity to Human, mouse, rat samples 29941-1-AP targets UNC5D in WB, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse kidney tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information UNC5D, also named as KIAA1777 and UNC5H4, belongs to the unc-5 family. It is a receptor for netrin. It may be involved in axon guidance by mediating axon repulsion of neuronal growth cones in the developing nervous system upon ligand binding. Axon repulsion in growth cones may be caused by its association with DCC that may trigger signaling for repulsion. It also acts as a dependence receptor required for apoptosis induction when not associated with netrin ligand. Previous studies have demonstrated that UNC5D can be cleavaged by caspase 2 and 3, suggesting that UNC5D serves as a direct substrate for caspases 2 and 3 (PMID: 23778138). Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31973 Product name: Recombinant human UNC5D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 33-152 aa of NM_080872 Sequence: ARGTDNGEALPESIPSAPGTLPHFIEEPDDAYIIKSNPIALRCKARPAMQIFFKCNGEWVHQNEHVSEETLDESSGLKVREVFINVTRQQVEDFHGPEDYWCQCVAWSHLGTSKSRKASV Predict reactive species Full Name: unc-5 homolog D (C. elegans) Calculated Molecular Weight: 106KD Observed Molecular Weight: 120 kDa, 68 kDa GenBank Accession Number: NM_080872 Gene Symbol: UNC5D Gene ID (NCBI): 137970 RRID: AB_3086195 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6UXZ4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.