Proteintech, 29942-1-AP, DSG3 Polyclonal antibody

Size: 20ul / 150ul The DSG3 (29942-1-AP) by Proteintech is a Polyclonal antibody targeting DSG3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 29942-1-AP targets DSG3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A431 cells, HaCaT cells Positive IHC detected in: mouse tongue tissue, human lung squamous cell carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HaCaT cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information DSG3, Desmoglein-3, is the component of intercellular desmosome junctions. Desmosomes are cell-cell junctions between epithelial, myocardial, and certain other cell types. DSG3 is a calcium-binding transmembrane glycoprotein component of desmosomes in vertebrate epithelial cells. It is involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. DSG3 is expressed in the basal lower layers of in the skin epidermis (PMID: 30528827). It acts as a prognostic marker of Esophageal Squamous cell carcinoma (PMID:24568510). Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30880 Product name: Recombinant human DSG3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 760-880 aa of NM_001944 Sequence: SGQSGTMRTRHSTGGTNKDYADGAISMNFLDSYFSQKAFACAEEDDGQEANDCLLIYDNEGADATGSPVGSVGCCSFIADDLDDSFLDSLGPKFKKLAEISLGVDGEGKEVQPPSKDSGYG Predict reactive species Full Name: desmoglein 3 (pemphigus vulgaris antigen) Calculated Molecular Weight: 108 kDa Observed Molecular Weight: 130 kDa GenBank Accession Number: NM_001944 Gene Symbol: DSG3 Gene ID (NCBI): 1830 RRID: AB_3086196 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P32926 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.