Proteintech, 29977-1-AP, KDM4A Polyclonal antibody

Size: 20ul / 150ul The KDM4A (29977-1-AP) by Proteintech is a Polyclonal antibody targeting KDM4A in WB, FC (Intra), IP, ELISA applications with reactivity to human, mouse samples 29977-1-AP targets KDM4A in WB, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, mouse lung tissue, MCF-7 cells, MDA-MB-231 cells, NCl-H1299 cells Positive IP detected in: MCF-7 cells, A549 cells Positive FC (Intra) detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information KDM4A also named as JHDM3A, JMJD2, or KIAA0677 is a 1066 amino acid protein, which contains one JmjC domain, two Tudor domains and two PHD-type zinc fingers. KDM4A localizes in nucleus and belongs to the JHDM3 histone demethylase family. KDM4A is histone de-methylase that specifically demethylates Lys 9 and Lys 36 residues of Histone H3, thereby playing a central role in histone code. JMJD2A demethylation of lysine residues will generate formaldehyde and succinate. KDM4A also participates in transcriptional repression of ASCL2 and E2F-responsive promoters via the recruitment of histone deacetylases and NCOR1, respectively. JMJD2A is a ubiquitously expressed nuclear protein. KDM4A exists as two isoforms. The short isoform of KDM4A in which the N-terminal demethylase domains has been deleted. The molecular weight of short isoform is 55Da. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31992 Product name: Recombinant human KDM4A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 584-720 aa of BC002558 Sequence: MFSLEENKKSKGRRQPLSKLPRHHPLVLQECVSDDETSEQLTPEEEAEETEAWAKPLSQLWQNRPPNFEAEKEFNETMAQQAPHCAVCMIFQTYHQVEFGGFNQNCGNASDLAPQKQRTKPLIPEMCFTSTGCSTDI Predict reactive species Full Name: lysine (K)-specific demethylase 4A Calculated Molecular Weight: 1064 aa, 121 kDa Observed Molecular Weight: 130-150 kDa GenBank Accession Number: BC002558 Gene Symbol: KDM4A Gene ID (NCBI): 9682 RRID: AB_2923625 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75164 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.