Iright
BRAND / VENDOR: Proteintech

Proteintech, 29997-1-AP, WDR73 Polyclonal antibody

CATALOG NUMBER: 29997-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The WDR73 (29997-1-AP) by Proteintech is a Polyclonal antibody targeting WDR73 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 29997-1-AP targets WDR73 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, mouse cerebellum tissue, rat kidney tissue Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Background Information WDR73 contains multiple WD40 repeat domains that function as scaffolds for the assembly of protein complexes. WDR73 was present in the brain and kidney and was located diffusely in the cytoplasm during interphase but relocalized to spindle poles and astral microtubules during mitosis. WDR73 interacts with microtubules to regulate cell cycle progression, proliferation, and survival in the brain and kidney(PMID: 26070982). Reduced expression of WDR73 results in abnormalities in the size and morphology of the nucleus. Mutations in WDR73 have been associated with Galloway-Mowat syndrome, which is a rare autosomal recessive disorder that affects both the central nervous system and the kidney (PMID: 25466283). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31818 Product name: Recombinant human WDR73 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 112-378 aa of BC063392 Sequence: QVAEDSDVIKAVSTIAVHEKEESLWPRVAVFSTLAPGVLHGARLRSLQVVDLESRKTTYTSDVSDSEELSSLQVLDADTFAFCCASGRLGLVDTRQKWAPLENRSPGPGSGGERWCAEVGSWGQGPGPSIASLGSDGRLCLLDPRDLCHPVSSVQCPVSVPSPDPELLRVTWAPGLKNCLAISGFDGTVQVYDATSWDGTRSQDGTRSQVEPLFTHRGHIFLDGNGMDPAPLVTTHTWHPCRPRTLLSATNDASLHVWDWVDLCAPR Predict reactive species Full Name: WD repeat domain 73 Observed Molecular Weight: 41 kDa GenBank Accession Number: BC063392 Gene Symbol: WDR73 Gene ID (NCBI): 84942 RRID: AB_3086206 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6P4I2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924