Proteintech, 30012-1-AP, IL3RA/CD123 Polyclonal antibody

Size: 20ul / 150ul The IL3RA/CD123 (30012-1-AP) by Proteintech is a Polyclonal antibody targeting IL3RA/CD123 in WB, IF-P, ELISA applications with reactivity to mouse, rat samples 30012-1-AP targets IL3RA/CD123 in WB, IF-P, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: PC-12 cells, NIH/3T3 cells Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information IL-3RA, also named as CD123 and SUT-1, is the alpha subunit of the interleukin 3 (IL-3) receptor, which is part of the type I cytokine receptor superfamily (PMID: 25043189). It can regulate the proliferation, survival, and differentiation of hematopoietic cells. In mouse, there are two classes of high-affinity IL-3 receptors. One contains an IL-3-specific beta subunit and the other contains the beta subunit also shared by high-affinity IL-5 and GM-CSF receptors. This antibody is specific for mouse Il3ra. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32002 Product name: Recombinant mouse Il3ra protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 17-331 aa of NM_008369 Sequence: SDLAAVREAPPTAVTTPIQNLHIDPAHYTLSWDPAPGADITTGAFCRKGRDIFVWADPGLARCSFQSLSLCHVTNFTVFLGKDRAVAGSIQFPPDDDGDHEAAAQDLRCWVHEGQLSCQWERGPKATGDVHYRMFWRDVRLGPAHNRECPHYHSLDVNTAGPAPHGGHEGCTLDLDTVLGSTPNSPDLVPQVTITVNGSGRAGPVPCMDNTVDLQRAEVLAPPTLTVECNGSEAHARWVARNRFHHGLLGYTLQVNQSSRSEPQEYNVSIPHFWVPNAGAISFRVKSRSEVYPRKLSSWSEAWGLVCPPEVMPVK Predict reactive species Full Name: interleukin 3 receptor, alpha chain Calculated Molecular Weight: 43 kDa Observed Molecular Weight: 43 kDa, 60-70 kDa GenBank Accession Number: NM_008369 Gene Symbol: Il3ra Gene ID (NCBI): 16188 RRID: AB_3086209 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P26952 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.