Proteintech, 30017-1-AP, BAK Polyclonal antibody

Size: 20ul / 150ul The BAK (30017-1-AP) by Proteintech is a Polyclonal antibody targeting BAK in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 30017-1-AP targets BAK in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, Neuro-2a cells, PC-12 cells, HeLa cells, THP-1 cells Positive IP detected in: HEK-293 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form oligomers or heterodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein localizes to mitochondria, and functions to induce apoptosis. It interacts with and accelerates the opening of the mitochondrial voltage-dependent anion channel, which leads to a loss in membrane potential and the release of cytochrome c. This protein also interacts with the tumor suppressor P53 after exposure to cell stress. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: rat, duck Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27958 Product name: Recombinant human BAK protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-124 aa of BC004431 Sequence: MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGIN Predict reactive species Full Name: BCL2-antagonist/killer 1 Calculated Molecular Weight: 23 kDa Observed Molecular Weight: 23-25 kDa GenBank Accession Number: BC004431 Gene Symbol: BAK1 Gene ID (NCBI): 578 RRID: AB_3086211 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16611 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.