Iright
BRAND / VENDOR: Proteintech

Proteintech, 30028-1-AP, BCKDHA Polyclonal antibody

CATALOG NUMBER: 30028-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The BCKDHA (30028-1-AP) by Proteintech is a Polyclonal antibody targeting BCKDHA in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples 30028-1-AP targets BCKDHA in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, HepG2 cells, rat liver tissue Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information branched chain keto acid dehydrogenase E1, alpha polypeptide (BCKDHA), the gene encoding the regulated subunit of BCKDC was only one of two primary susceptibility genes identified that affected the risk of both type 2 diabetes mellitus (T2DM) and obesity (PMID: 25287287). BIX01294 transcriptionally downregulated the transcription of BCKDHA, which is essential for fueling the tricarboxylic acid (TCA) cycle. Studies have shown that KDM3A, a Jumonji histone demethylase, epigenetically regulates BCKDHA expression by binding to the BCKDHA gene promoter (PMID: 34876693). Moreover, at least four genes including BCKDHA, branched chain keto acid dehydrogenase E1, beta polypeptide (BCKDHB), dihydrolipoamide dehydrogenase (DLD), and dihydrolipoamide branched chain transacylase E2 (DBT) have been reported to be the causative gene for Maple syrup urine disease (MSUD) (PMID: 34187135). Specification Tested Reactivity: Human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32613 Product name: Recombinant human BCKDHA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 264-445 aa of BC008933 Sequence: CRNNGYAISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQEMPAQLRKQQESLARHLQTYGEHYPLDHFDK Predict reactive species Full Name: branched chain keto acid dehydrogenase E1, alpha polypeptide Calculated Molecular Weight: 50 kDa Observed Molecular Weight: 42-50 kDa GenBank Accession Number: BC008933 Gene Symbol: BCKDHA Gene ID (NCBI): 593 RRID: AB_2935504 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P12694 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924