Iright
BRAND / VENDOR: Proteintech

Proteintech, 30035-1-AP, ATP2B1 Polyclonal antibody

CATALOG NUMBER: 30035-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ATP2B1 (30035-1-AP) by Proteintech is a Polyclonal antibody targeting ATP2B1 in WB, IHC, ELISA applications with reactivity to Human, mouse samples 30035-1-AP targets ATP2B1 in WB, IHC, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: 37°C incubated mouse brain tissue Positive IHC detected in: human pancreas cancer tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information ATPase plasma membrane Ca2+ transporting 1 (ATP2B1, also known as plasma membrane Ca2+ pump isoform 1; PMCA1) belongs to the family of ATP-driven calmodulin-dependent Ca2+ pumps that participate in the regulation of intracellular free Ca2+ (PMID:35358416). The ATP2B1 contents of extracellular vesicles are increased in prostate cancer treated with enzalutamide and are negatively regulated by androgen receptors (PMID:29105980). ATP2B1 plays an important role in the prognosis of cholangiocarcinoma. Furthermore, ATP2B1 plays an important role in the prognosis of cholangiocarcinoma and can be a prognostic factor for cholangiocarcinoma (PMID:35875160). Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32423 Product name: Recombinant human ATP2B1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-89 aa of NM_001001323.1 Sequence: GDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNF Predict reactive species Full Name: ATPase, Ca++ transporting, plasma membrane 1 Calculated Molecular Weight: 135 kDa Observed Molecular Weight: 130-180 kDa GenBank Accession Number: NM_001001323.1 Gene Symbol: ATP2B1 Gene ID (NCBI): 490 RRID: AB_3086214 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P20020 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924