Proteintech, 30037-1-AP, SCNN1G Polyclonal antibody

Size: 20ul / 150ul The SCNN1G (30037-1-AP) by Proteintech is a Polyclonal antibody targeting SCNN1G in WB, ELISA applications with reactivity to human, pig samples 30037-1-AP targets SCNN1G in WB, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: A431 cells, COLO 320 cells, PC-3 cells, pig kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information SCNN1G (sodium channel, non-voltage-gated 1, gamma), also known as ENaC gamma (epithelial Na(+) channel subunit gamma) or amiloride-sensitive sodium channel subunit gamma, is the gamma subunit of the epithelial Na(+) channel (ENaC). ENaC is expressed in the apical membrane of salt-absorbing epithelia of the kidney, distal colon, and lung. ENaC is a non-voltage gated, constitutively active channel highly selective for sodium. It has an essential role in salt and fluid homeostasis across epithelial tissues. Mutations in the gene of SCNN1G have been associated with Liddle syndrome. Native SCNN1G has a calculated molecular weight of 74 kDa and may undergo post-transcriptional modifications, including glycosylation and proteolytic cleavage (PMID: 12871941; 18086683). Specification Tested Reactivity: human, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32176 Product name: Recombinant human SCNN1G protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 87-215 aa of BC059391 Sequence: VHFRKLDFPAVTICNINPYKYSTVRHLLADLEQETREALKSLYGFPESRKRREAESWNSVSEGKQPRFSHRIPLLIFDQDEKGKARDFFTGRKRKVGGSIIHKASNVMHIESKQVVGFQLCSNDTSDCA Predict reactive species Full Name: sodium channel, nonvoltage-gated 1, gamma Calculated Molecular Weight: 74 kDa Observed Molecular Weight: 74 kDa GenBank Accession Number: BC059391 Gene Symbol: SCNN1G Gene ID (NCBI): 6340 RRID: AB_3669702 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P51170 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.