Iright
BRAND / VENDOR: Proteintech

Proteintech, 30041-1-AP, KEAP1 Polyclonal antibody

CATALOG NUMBER: 30041-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KEAP1 (30041-1-AP) by Proteintech is a Polyclonal antibody targeting KEAP1 in WB, ELISA applications with reactivity to Human samples 30041-1-AP targets KEAP1 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells, Jurkat cells, MCF-7 cells, NK-92 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information KEAP1, also named as INRF2, KIAA0132 and KLHL19, is part of a multiprotein complex that contains the CUL3-ROC1 ubiquitin ligase, which can ubiquitinate the N-terminal domain of NRF2[PMID: 20173742]. Two molecules of KEAP1 bind to two distinct sites in the N-terminal region of NRF2, the ETGE and DLG sites, which affect the KEAP1-NRF2 interaction and/or its physiological consequences[PMID: 22215675]. KEAP1 retains NFE2L2/NRF2 in the cytosol. It functions as substrate adapter protein for the E3 ubiquitin ligase complex formed by CUL3 and RBX1[PMID: 20427290]. It also retains BPTF in the cytosol. This antibody is a rabbit polyclonal antibody raised against residues near the C terminus of human KEAP1. Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32512 Product name: Recombinant human KEAP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 480-624 aa of BC002930 Sequence: GTNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVTMEPCRKQIDQQNCTC Predict reactive species Full Name: kelch-like ECH-associated protein 1 Calculated Molecular Weight: 624 aa, 70 kDa Observed Molecular Weight: 55-70 kDa GenBank Accession Number: BC002930 Gene Symbol: KEAP1 Gene ID (NCBI): 9817 RRID: AB_2935506 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14145 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924