Proteintech, 30044-1-AP, RBPJ Polyclonal antibody

Size: 20ul / 150ul The RBPJ (30044-1-AP) by Proteintech is a Polyclonal antibody targeting RBPJ in WB, IP, IHC, ELISA applications with reactivity to Human, mouse samples 30044-1-AP targets RBPJ in WB, IHC, IP, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, MCF-7 cells, NIH/3T3 cells Positive IP detected in: HepG2 cells Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information RBPJ, also named as IGKJRB, IGKJRB1, RBPJK, RBPSUH, NY-REN-30, CBF-1 and CSL, belongs to the Su(H) family. It is a transcriptional regulator that plays a central role in Notch signaling, a signaling pathway involved in cell-cell communication that regulates a broad spectrum of cell-fate determinations. RBPJ acts as a transcriptional repressor when it is not associated with Notch proteins. It is specifically binds to the immunoglobulin kappa-type J segment recombination signal sequence. RBPJ binds to the Runx3 promoter in the atrioventricular canal in vivo, and inhibition of Notch reduces RUNX3 expression in the cardiac cushion of embryonic hearts. Specification Tested Reactivity: Human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32552 Product name: Recombinant human RBPJ protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 380-486 aa of BC064976 Sequence: MYRCGESMLCVVPDISAFREGWRWVRQPVQVPVTLVRNDGIIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGSYTNASTNSTSVTSSTATVVS Predict reactive species Full Name: recombination signal binding protein for immunoglobulin kappa J region Calculated Molecular Weight: 56 kDa Observed Molecular Weight: ~60 kDa GenBank Accession Number: BC064976 Gene Symbol: RBPJ Gene ID (NCBI): 3516 RRID: AB_3086217 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q06330 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.