Iright
BRAND / VENDOR: Proteintech

Proteintech, 30073-1-AP, DNAH6 Polyclonal antibody

CATALOG NUMBER: 30073-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DNAH6 (30073-1-AP) by Proteintech is a Polyclonal antibody targeting DNAH6 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 30073-1-AP targets DNAH6 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: hTERT-RPE1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information DNAH6(Dynein heavy chain 6, axonemal) is also named as DNAHC6, DNHL1, HL2, KIAA1697 and belongs to the dynein heavy chain family.Dyneins are microtubule-associated motor protein complexes composed of several heavy, light, and intermediate chains(PMID:8812413). It is a force generating protein of respiratory cilia and produces force towards the minus ends of microtubules.This antibody is specific to DNAH6. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32364 Product name: Recombinant human DNAH6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 148-408 aa of BC104884 Sequence: NNKLEGKTCGTGPSLAAVFEDDKNFHTIISQIKETIQAAFESARIYAATFEKFQIFFKENESLDLQALKLQEPDINFFSEQLEKYHKQHKDAVALRPTRNVGLLLIDTRLLREKLIPSPLRCLEVLNFMLPRQSKKKVDAIIFEAQDAEYKLEFVPTTTTEYVHSLLFLDEIQERIESLEDEGNIVTQMYKLMEQYQVPTPPEDFAVFATMKPSIVAVRNAIDKSVGDRESSIKQFCVHLGSDLEELNNEVNEVKLQAQVS Predict reactive species Full Name: dynein, axonemal, heavy chain 6 Calculated Molecular Weight: 475 kDa Observed Molecular Weight: 475 kDa GenBank Accession Number: BC104884 Gene Symbol: DNAH6 Gene ID (NCBI): 1768 RRID: AB_2935510 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9C0G6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924