Proteintech, 30081-1-AP, MCCC1 Polyclonal antibody

Size: 20ul / 150ul The MCCC1 (30081-1-AP) by Proteintech is a Polyclonal antibody targeting MCCC1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 30081-1-AP targets MCCC1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, mouse brain tissue, mouse heart tissue, rat brain tissue Positive IHC detected in: human ovary cancer tissue, human intrahepatic cholangiocarcinoma tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U-251 cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information MCCC1 is the large subunit of 3-methylcrotonyl-CoA carboxylase. This enzyme functions as a heterodimer and catalyzes the carboxylation of 3-methylcrotonyl-CoA to form 3-methylglutaconyl-CoA. Mutations in this gene are associated with 3-Methylcrotonylglycinuria, an autosomal recessive disorder of leucine catabolism. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32459 Product name: Recombinant human MCCC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 42-200 aa of BC004187 Sequence: TTATGRNITKVLIANRGEIACRVMRTAKKLGVQTVAVYSEADRNSMHVDMADEAYSIGPAPSQQSYLSMEKIIQVAKTSAAQAIHPGCGFLSENMEFAELCKQEGIIFIGPPPSAIRDMGIKSTSKSIMAAAGVPVVEGYHGEDQSDQCLKEHARRIGY Predict reactive species Full Name: methylcrotonoyl-Coenzyme A carboxylase 1 (alpha) Calculated Molecular Weight: 76 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC004187 Gene Symbol: MCCC1 Gene ID (NCBI): 56922 RRID: AB_3086226 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96RQ3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.