Iright
BRAND / VENDOR: Proteintech

Proteintech, 30082-1-AP, FOXC1 Polyclonal antibody

CATALOG NUMBER: 30082-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FOXC1 (30082-1-AP) by Proteintech is a Polyclonal antibody targeting FOXC1 in WB, ELISA applications with reactivity to human samples 30082-1-AP targets FOXC1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information FOXC1, also named as FKHL7 and FREAC3, binding of FREAC-3 and FREAC-4 to their cognate sites results in bending of the DNA at an angle of 80-90 degrees. Defects in FOXC1 are the cause of Axenfeld-Rieger syndrome type 3 (RIEG3). Defects in FOXC1 are the cause of iridogoniodysgenesis anomaly (IGDA). Defects in FOXC1 are a cause of Peters anomaly. This antibody is specific to FOXC1. Phosphorylation modification of Foxc1 protein may be responsible for the larger molecular weight of detection compared with theoretical molecular weight (PMID:27708239;16403239). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32531 Product name: Recombinant human FOXC1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 404-553 aa of NM_001453.3 Sequence: AAGERGGHLQGAPGGAGGSAVDDPLPDYSLPPVTSSSSSSLSHGGGGGGGGGGQEAGHHPAAHQGRLTSWYLNQAGGDLGHLASAAAAAAAAGYPGQQQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDCSKF Predict reactive species Full Name: forkhead box C1 Calculated Molecular Weight: 57kd Observed Molecular Weight: 70 kDa GenBank Accession Number: NM_001453.3 Gene Symbol: FOXC1 Gene ID (NCBI): 2296 RRID: AB_2935512 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q12948 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924