Proteintech, 30107-1-AP, C5orf51 Polyclonal antibody

Size: 20ul / 150ul The C5orf51 (30107-1-AP) by Proteintech is a Polyclonal antibody targeting C5orf51 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, mouse samples 30107-1-AP targets C5orf51 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293T cells, HepG2 cells Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32440 Product name: Recombinant human C5orf51 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 203-293 aa of XM_011514032 Sequence: FSDIHLLAMMYSGEMCYWGSKYCADQQPENHEVDTSVSGAGCTTYKEPLDFREVGEKILKKYVSVCEGPLKEQEWNTTNAKQILNFFHHRCN Predict reactive species Full Name: chromosome 5 open reading frame 51 Calculated Molecular Weight: 34kd Observed Molecular Weight: 34-40 kDa GenBank Accession Number: XM_011514032 Gene Symbol: C5orf51 Gene ID (NCBI): 285636 RRID: AB_3086230 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A6NDU8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.