Iright
BRAND / VENDOR: Proteintech

Proteintech, 30114-1-AP, NFATC1 Polyclonal antibody

CATALOG NUMBER: 30114-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NFATC1 (30114-1-AP) by Proteintech is a Polyclonal antibody targeting NFATC1 in WB, IF/ICC, ELISA applications with reactivity to Human samples 30114-1-AP targets NFATC1 in WB, IF/ICC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HEK-293 cells Positive IF/ICC detected in: U-251 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Nuclear factor of activated T-cells cytoplasmic (NFATC) is a family of transcription factors originally identified in T-cells. The family has five members (NFATC1 through NFATC5), which play roles both within and outside the immune system. NFATC1 is widely expressed and resides in endocardial cushion endothelial cells, skeletal muscle fibers, T lymphocytes, osteoblasts, osteoclasts, etc. The autoregulation of NFATC1 is a crucial step for cell fate determination. It is a master regulator of RANKL-induced osteoclast differentiation and plays a pivotal role in osteoclast fusion and osteoclast activation via up-regulation of various genes responsible for osteoclast adhesion, migration, acidification, degradation of inorganic and organic bone matrix (PMID: 20035895, PMID: 19754901). NFAT proteins is alternatively modified to generate splice variants. NFATC1 can be detected isoforms of 82-140 kDa (PMID: 18097033). Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32365 Product name: Recombinant human NFATC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 197-304 aa of BC104753 Sequence: YASPQTSPWQSPCVSPKTTDPEEGFPRGLGACTLLGSPRHSPSTSPRASVTEESWLGARSSRPASPCNKRKYSLNGRQPPYSPHHSPTPSPHGSPRVSVTDDSWLGNT Predict reactive species Full Name: nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 1 Calculated Molecular Weight: 716aa,78 kDa; 943aa,101 kDa Observed Molecular Weight: 82-140 kDa GenBank Accession Number: BC104753 Gene Symbol: NFATC1 Gene ID (NCBI): 4772 RRID: AB_3086233 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95644 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924