Proteintech, 30115-1-AP, KNOP1 Polyclonal antibody

Size: 20ul / 150ul The KNOP1 (30115-1-AP) by Proteintech is a Polyclonal antibody targeting KNOP1 in WB, IF/ICC, ELISA applications with reactivity to human samples 30115-1-AP targets KNOP1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, U-251 cells, MCF-7 cells Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:14000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Lysine-rich nucleolar protein 1 (KNOP1) is a nucleolar protein that interacts with zinc finger 106 protein. Also known as Tsg118, it was first reported in 1999 (3). KNOP1 is predominantly expressed in proliferating somatic cells and in male germ cells, and may therefore be involved in testicular development. (PMID: 37588747) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32395 Product name: Recombinant human KNOP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 260-458 aa of NM_001012991.2 Sequence: DDPKASAKKKMKSKKKVEQPVIEEPALKRKKKKKRKESGVAGDPWKEETDTDLEVVLEKKGNMDEAHIDQVRRKALQEEIDRESGKTEASETRKWTGTQFGQWDTAGFENEDQKLKFLRLMGGFKNLSPSFSRPASTIARPNMALGKKAADSLQQNLQRDYDRAMSWKYSRGAGLGFSTAPNKIFYIDRNASKSVKLED Predict reactive species Full Name: chromosome 16 open reading frame 88 Calculated Molecular Weight: 52 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: NM_001012991.2 Gene Symbol: KNOP1 Gene ID (NCBI): 400506 RRID: AB_3086234 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q1ED39 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.