Proteintech, 30120-1-AP, ST3GAL5 Polyclonal antibody

Size: 20ul / 150ul The ST3GAL5 (30120-1-AP) by Proteintech is a Polyclonal antibody targeting ST3GAL5 in WB, IF/ICC, ELISA applications with reactivity to Human, mouse samples 30120-1-AP targets ST3GAL5 in WB, IF/ICC, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, Jurkat cells, human placenta tissue, mouse testis tissue Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information ST3GAL5 is also named as SIAT9, GM3 synthase, ST3Gal V, Sialyltransferase 9 and belongs to the glycosyltransferase 29 family. ST3GAL5 transfers the sialyl group (N-acetyl-alpha-neuraminyl or NeuAc) from CMP-NeuAc to the non-reducing terminal galactose of glycosphingolipids forming gangliosides (PMID:9822625, PMID:16934889). SIAT9 is mainly involved in the biosynthesis of ganglioside GM3 but can also use different glycolipids as substrate acceptors such as D-galactosylceramide (GalCer), asialo-GM2 (GA2) and asialo-GM1 (GA1) (PMID:16934889). ST3GAL5 is high expression in brain, skeletal muscle, placenta, and testis. And mRNA of ST3GAL5 is widely distributed in human brain, but slightly elevated expression was observed in the cerebral cortex, temporal lobe, and putamen (PMID:9822625). This antibody recognizes the glycosylated form of ST3GAL5 (PMID: 34943806, PMID: 26458842). Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32461 Product name: Recombinant human ST3GAL5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 230-418 aa of BC065936 Sequence: YSEHVGNKTTIRMTYPEGAPLSDLEYYSNDLFVAVLFKSVDFNWLQAMVKKETLPFWVRLFFWKQVAEKIPLQPKHFRILNPVIIKETAFDILQYSEPQSRFWGRDKNVPTIGVIAVVLATHLCDEVSLAGFGYDLNQPRTPLHYFDSQCMAAMNFQTMHNVTTETKFLLKLVKEGVVKDLSGGIDREF Predict reactive species Full Name: ST3 beta-galactoside alpha-2,3-sialyltransferase 5 Calculated Molecular Weight: 48 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC065936 Gene Symbol: ST3GAL5 Gene ID (NCBI): 8869 RRID: AB_3086237 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UNP4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.