Proteintech, 30130-1-AP, SMAD3 Polyclonal antibody

Size: 20ul / 150ul The SMAD3 (30130-1-AP) by Proteintech is a Polyclonal antibody targeting SMAD3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 30130-1-AP targets SMAD3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells Positive IHC detected in: human stomach cancer tissue, mouse stomach tissue, rat stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information SMAD3, also named as hMAD 3 or Mad3, is a 425 amino acid protein, which contains one MH1 domain and one MH2 domain. SMAD3 localizes in the nucleus and cytoplasm. SMAD3 plays an essential role in development and maintenance of self-tolerance and is a critical mediator of the TGFB signaling pathway. SMAD3 is involved in TGFB dependent regulation of steroidogenesis and in T-cell response to TGFB. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32595 Product name: Recombinant human SMAD3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 145-260 aa of NM_005902 Sequence: EIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGF Predict reactive species Full Name: SMAD family member 3 Calculated Molecular Weight: 48 kDa Observed Molecular Weight: 48-55 kDa GenBank Accession Number: NM_005902 Gene Symbol: SMAD3 Gene ID (NCBI): 4088 RRID: AB_3662144 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P84022 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.