Iright
BRAND / VENDOR: Proteintech

Proteintech, 30131-1-AP, NOX3 Polyclonal antibody

CATALOG NUMBER: 30131-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NOX3 (30131-1-AP) by Proteintech is a Polyclonal antibody targeting NOX3 in WB, ELISA applications with reactivity to Human, mouse samples 30131-1-AP targets NOX3 in WB, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, MCF-7 cells, HEK-293 cells, PC-12 cells, mouse kidney tissue, mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information NOX3 is a member of NADPH oxidase which constitutively produces superoxide upon formation of a complex with CYBA/p22phox. NOX3 plays a role in the biogenesis of otoconia/otolith, which are crystalline structures of the inner ear involved in the perception of gravity. The antibody is specific to NOX3. Specification Tested Reactivity: Human, mouse Cited Reactivity: pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32601 Product name: Recombinant human NOX3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 223-395 aa of NM_015718 Sequence: GRIVRGQTQDSLSLHNITFCRDRYAEWQTVAQCPVPQFSGKEPSAWKWILGPVVLYACERIIRFWRFQQEVVITKVVSHPSGVLELHMKKRGFKMAPGQYILVQCPAISSLEWHPFTLTSAPQEDFFSVHIRAAGDWTAALLEAFGAEGQALQEPWSLPRLAVDGPFGTALTD Predict reactive species Full Name: NADPH oxidase 3 Calculated Molecular Weight: 64kd Observed Molecular Weight: 65 kDa GenBank Accession Number: NM_015718 Gene Symbol: NOX3 Gene ID (NCBI): 50508 RRID: AB_2935517 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HBY0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924