Iright
BRAND / VENDOR: Proteintech

Proteintech, 30141-1-AP, KIF13B Polyclonal antibody

CATALOG NUMBER: 30141-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KIF13B (30141-1-AP) by Proteintech is a Polyclonal antibody targeting KIF13B in WB, IHC, IP, ELISA applications with reactivity to human samples 30141-1-AP targets KIF13B in WB, IHC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells, HeLa cells, Jurkat cells, K-562 cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:150-1:600 Background Information KIF13B, Also known as GAKIN, is a 250-kD phosphoprotein. KIF13B contains a consensus ATP/GTP-binding motif within its N-terminal motor domain; a stalk domain containing several short alpha-helical segments; and a CAP-gly motif in its C terminus characteristic of microtubule-based cytoskeleton components(PMID: 10859302). Specification Tested Reactivity: human Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30876 Product name: Recombinant human KIF13B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1648-1826 aa of NM_015254 Sequence: VRRVRASELRSFSRMLAGDPGCSPGAEGNAPAPGAGGQALASDSEEADEVPEWLREGEFVTVGAHKTGVVRYVGPADFQEGTWVGVELDLPSGKNDGSIGGKQYFRCNPGYGLLVRPSRVRRATGPVRRRSTGLRLGAPEARRSATLSGSATNLASLTAALAKADRSHKNPENRKSWAS Predict reactive species Full Name: kinesin family member 13B Calculated Molecular Weight: 203 kDa Observed Molecular Weight: 250 kDa GenBank Accession Number: NM_015254 Gene Symbol: KIF13B Gene ID (NCBI): 23303 RRID: AB_3086245 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NQT8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924