Iright
BRAND / VENDOR: Proteintech

Proteintech, 30146-1-AP, SEPT3 Polyclonal antibody

CATALOG NUMBER: 30146-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SEPT3 (30146-1-AP) by Proteintech is a Polyclonal antibody targeting SEPT3 in WB, IHC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 30146-1-AP targets SEPT3 in WB, IHC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information SEPT3 is a developmentally regulated phosphoprotein. SEPT3 is a member of the septin GTPase family, which can form polymers and contribute to the cytoskeleton. SEPT3 is involved in neuronal autophagy. In the process of autophagy regulation, the level of SEPT3 will change according to the autophagy protein. SEPT3 is specifically expressed in the brain (PMID: 15485489; 35932293). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32890 Product name: Recombinant human SEPT3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 264-345 aa of BC111779 Sequence: VLGRKTPWGIIEVENLNHCEFALLRDFVIRTHLQDLKEVTHNIHYETYRAKRLNDNGGLPPGEGLLGTVLPPVPATPCPTAE Predict reactive species Full Name: septin 3 Calculated Molecular Weight: 358 aa, 41 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC111779 Gene Symbol: SEPT3 Gene ID (NCBI): 55964 RRID: AB_2935520 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UH03 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924