Proteintech, 30148-1-AP, GGT5 Polyclonal antibody

Size: 20ul / 150ul The GGT5 (30148-1-AP) by Proteintech is a Polyclonal antibody targeting GGT5 in WB, IHC, ELISA applications with reactivity to human, mouse samples 30148-1-AP targets GGT5 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: 3T3-L1 cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Gamma-glutamyltransferase 5 (GGT5) is one of the two GGT family members (GGT1 and GGT5) with catalytic activity identified to date and was first reported in 2008 (PMID:18357469). GGT5 is widely distributed in a variety of tissues, with relatively high expression in liver, kidney, and alveolar macrophages (PMID:25377544). GGT5 played a pivotal role in oxidative regulation, drug metabolism, and immune modulation in the human body (PMID:21447318). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32373 Product name: Recombinant human GGT5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 387-527 aa of BC011362 Sequence: GTSHVSVLGEDGSAVAATSTINTPFGAMVYSPRTGIILNNELLDLCERCPRGSGTTPSPVSGDRVGGAPGRCWPPVPGERSPSSMVPSILINKAQGSKLVIGGAGGELIISAVAQAIMSKLWLGFDLRAAIAAPILHVNSK Predict reactive species Full Name: gamma-glutamyltransferase 5 Calculated Molecular Weight: 586 aa, 62 kDa Observed Molecular Weight: 55-60 kDa GenBank Accession Number: BC011362 Gene Symbol: GGT5 Gene ID (NCBI): 2687 RRID: AB_3086247 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P36269 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.