Iright
BRAND / VENDOR: Proteintech

Proteintech, 30162-1-AP, FBXO44 Polyclonal antibody

CATALOG NUMBER: 30162-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FBXO44 (30162-1-AP) by Proteintech is a Polyclonal antibody targeting FBXO44 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples 30162-1-AP targets FBXO44 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information FBXO44 is a member of the F-box protein family that shares a function as substrate recognition factors for the SKP1-CUL1-F-box (SCF)-type ubiquitin ligase. Several human FBXs (FBXO2, FBXO6, FBXO17, FBXO27, and FBXO44) share a conserved G domain (also known as FBA domain), which is responsible for recognizing N-glycan moieties by most FBXs in this group except FBXO44. (PMID: 25970626, PMID: 23086937) Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32432 Product name: Recombinant human FBXO44 protein Source: e coli. -derived, PKG Tag: GST Domain: 82-122 aa of BC007832 Sequence: LHNPCAEEGFEFWSLDVNGGDEWKVEDLSRDQRKEFPNDQV Predict reactive species Full Name: F-box protein 44 Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC007832 Gene Symbol: FBXO44 Gene ID (NCBI): 93611 RRID: AB_3086253 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H4M3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924