Iright
BRAND / VENDOR: Proteintech

Proteintech, 30165-1-AP, CEP89, CCDC123 Polyclonal antibody

CATALOG NUMBER: 30165-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CEP89, CCDC123 (30165-1-AP) by Proteintech is a Polyclonal antibody targeting CEP89, CCDC123 in WB, IF/ICC, ELISA applications with reactivity to human samples 30165-1-AP targets CEP89, CCDC123 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells Positive IF/ICC detected in: hTERT-RPE1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information CCDC123(as known as CEP123), also named as CEP89, is a new player in the process of primary ciliogenesis and it also plays a role in mitochondrial metabolism where it may modulate complex IV activity. It has been shown that CEP123 is localized to the distal appendages of the mother centriolecep and the localization of CEP123 is cell cycle-dependent with its levels decreasing during mitosis. CEP123 depletion can cause defects in ciliary vesicle formationcep and prevent the formation of a ciliary vesicle at the distal end of the mother centriole. It is possible that CEP123 is involved in regulating the recruitment of membranes to the centrosome through its interaction with Cep290(PMID:23575228, 23789104, 23348840). 24002-1-AP antibody recognizes all of CEP123 isoforms. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32789 Product name: Recombinant human CCDC123 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 575-783 aa of BC136328 Sequence: KINRKSQKKIEVLKKQVEKAMGNEMSAHQYLANLVGLAENITQERDSLMCLAKCLESEKDGVLNKVIKSNIRLGKLEEKVKGYKKQAALKLGDISHRLLEQQEDFAGKTAQYRQEMRHLHQVLKDKQEVLDQALQQNREMEGELEVIWESTFRENRRIRELLQDTLTRTGVQDNPRALVAPSLNGVSQADLLDGCDVCSYDLKSHAPTC Predict reactive species Full Name: coiled-coil domain containing 123 Calculated Molecular Weight: 783 aa, 90 kDa Observed Molecular Weight: 85-100 kDa GenBank Accession Number: BC136328 Gene Symbol: CEP89 Gene ID (NCBI): 84902 RRID: AB_3669704 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96ST8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924