Proteintech, 30185-1-AP, MEX3B Polyclonal antibody

Size: 20ul / 150ul The MEX3B (30185-1-AP) by Proteintech is a Polyclonal antibody targeting MEX3B in WB, ELISA applications with reactivity to human, mouse samples 30185-1-AP targets MEX3B in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: C2C12 cells, SGC-7901 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Human MEX3B (hMEX3B) protein is an RNA-binding protein that contains two KH domains at the N-terminus and a RING domain at its C-terminus, which has the activity of E3 ubiquitin ligase and is essential for RNA degradation. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32899 Product name: Recombinant human MEX3B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 300-458 aa of BC036211 Sequence: YFGGGTSSSAAATQRLADYSPPSPALSFAHNGNNNNNGNGYTYTAGGEASVPSPDGCPELQPTFDPAPAPPPGAPLIWAQFERSPGGGPAAPVSSSCSSSASSSASSSSVVFPGSGASAPSNANLGLLVHRRLHPGTSCPRLSPPLHMAPGAGEHHLAR Predict reactive species Full Name: mex-3 homolog B (C. elegans) Calculated Molecular Weight: 569 aa, 59 kDa Observed Molecular Weight: 60-70 kDa GenBank Accession Number: BC036211 Gene Symbol: MEX3B Gene ID (NCBI): 84206 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6ZN04 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.