Proteintech, 30186-1-AP, BRPF1 Polyclonal antibody

Size: 20ul / 150ul The BRPF1 (30186-1-AP) by Proteintech is a Polyclonal antibody targeting BRPF1 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human, rat samples 30186-1-AP targets BRPF1 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HeLa cells, PC-12 cells Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information BRPF1 (bromodomain and PHD finger-containing protein 1) is also named as BR140. BRPF1 is scaffold subunit of various histone acetyltransferase (HAT) complexes, such as the MOZ/MORF and HBO1 complexes, which have a histone H3 acetyltransferase activity (PMID:16387653, PMID:24065767, PMID:27939640). BRPF1 plays a key role in HBO1 complex by directing KAT7/HBO1 specificity towards histone H3 'Lys-14' acetylation (H3K14ac) (PMID:24065767). And BRPF1 positively regulates the transcription of RUNX1 and RUNX2 (PMID:18794358). Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32828 Product name: Recombinant human BRPF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 741-880 aa of BC053851 Sequence: QAEKMGIDFETGMHIPHSLAGDEATHHTEDAAEEERLVLLENQKHLPVEEQLKLLLERLDEVNASKQSVGRSRRAKMIKKEMTALRRKLAHQRETGRDGPERHGPSSRGSLTPHPAACDKDGQTDSAAEESSSQETSKGL Predict reactive species Full Name: bromodomain and PHD finger containing, 1 Calculated Molecular Weight: 1220 aa, 138 kDa Observed Molecular Weight: 140 kDa GenBank Accession Number: BC053851 Gene Symbol: BRPF1 Gene ID (NCBI): 7862 RRID: AB_2935526 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P55201 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.