Proteintech, 30189-1-AP, RASGRP2 Polyclonal antibody

Size: 20ul / 150ul The RASGRP2 (30189-1-AP) by Proteintech is a Polyclonal antibody targeting RASGRP2 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 30189-1-AP targets RASGRP2 in WB, IF/ICC, FC (Intra), CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, MOLT-4 cells, Raji cells Positive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Jurkat cells Positive FC (Intra) detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information RASGRP2, also named as CDC25L and MCG7, belongs to the RASGRP family. It functions as a calcium- and DAG-regulated nucleotide exchange factor specifically activating Rap through the exchange of bound GDP for GTP. RASGRP2 may also activate other GTPases such as RRAS, RRAS2, NRAS, KRAS but not HRAS. RASGRO2 functions in aggregation of platelets and adhesion of T-lymphocytes and neutrophils probably through inside-out integrin activation. It may function in the muscarinic acetylcholine receptor M1/CHRM1 signaling pathway. The antibody recognizes the C-term of RASGRP2. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32762 Product name: Recombinant human RASGRP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 370-609 aa of NM_153819 Sequence: QYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLEEWTSAAKPKLDQALVVEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEMVSYFLRSSSVLGGRMGFVHNFQESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQCKDRLSVECRRRAQSVSLEGSAPSPSPMHSHHHRAFSFSLPRPGRRGSRPPEIREEEVQTVEDGVFDIHL Predict reactive species Full Name: RAS guanyl releasing protein 2 (calcium and DAG-regulated) Calculated Molecular Weight: 69kd Observed Molecular Weight: 69 kDa GenBank Accession Number: NM_153819 Gene Symbol: RASGRP2 Gene ID (NCBI): 10235 RRID: AB_3086257 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7LDG7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.