Iright
BRAND / VENDOR: Proteintech

Proteintech, 30206-1-AP, LRP1 Polyclonal antibody

CATALOG NUMBER: 30206-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LRP1 (30206-1-AP) by Proteintech is a Polyclonal antibody targeting LRP1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 30206-1-AP targets LRP1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse liver tissue, HeLa cells, mouse lung tissue, rat liver tissue, rat lung tissue Positive IP detected in: mouse liver tissue Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information LRP1 (Prolow-density lipoprotein receptor-related protein 1), also known as A2MR, APOER and CD91, is a type I transmembrane protein that belongs to the LDLR family. LRP1 is synthesized as a transmembrane glycosylated precursor of 600 kDa, and is subsequently cleaved to generate a large 515-kDa N-terminal extracellular subunit and an 85-kDa C-terminal transmembrane subunit, which are noncovalently associated with one another (PMID: 2112085; 8546712). LRP1 is a multifunctional receptor involved in the clearance of a large number of diverse ligands and modulating various cellular processes. LRP1 is implicated in conditions such as atherosclerosis, cancer and neurodegenerative diseases (PMID: 28381441). This antibody is raised against 20-170 aa of human LRP1. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32507 Product name: Recombinant human LRP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-170 aa of BC045107 Sequence: AIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELQGNCSRLGCQHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGS Predict reactive species Full Name: low density lipoprotein-related protein 1 (alpha-2-macroglobulin receptor) Calculated Molecular Weight: 505 kDa Observed Molecular Weight: 505 kDa GenBank Accession Number: BC045107 Gene Symbol: LRP1 Gene ID (NCBI): 4035 RRID: AB_3086263 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q07954 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924