Iright
BRAND / VENDOR: Proteintech

Proteintech, 30234-1-AP, IL-1 beta Polyclonal antibody

CATALOG NUMBER: 30234-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The IL-1 beta (30234-1-AP) by Proteintech is a Polyclonal antibody targeting IL-1 beta in WB, ELISA applications with reactivity to Human samples 30234-1-AP targets IL-1 beta in WB, IF, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: THP-1 cells, U-87 MG cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Interleukin-1, produced mainly by blood monocytes, mediates the panoply of host reactions collectively known as acute phase response. It is identical to endogenous pyrogen. The multiple biologic activities that define IL1 are properties of a 15- to 18-kD protein that is derived from a 30- to 35-kD precursor. Interleukin 1β (IL-1B) is a member of the interleukin 1 cytokine family. It is a pro-inflammatory cytokine against infection, playing an important role in the pathogenesis of cancers. It signals through various adaptor proteins and kinases that lead to activation of numerous downstream targets Specification Tested Reactivity: Human Cited Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30574 Product name: Recombinant human IL-1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 117-269 aa of NM_000576 Sequence: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS Predict reactive species Full Name: interleukin 1, beta Calculated Molecular Weight: 31 kDa Observed Molecular Weight: 31 kDa GenBank Accession Number: NM_000576 Gene Symbol: IL1B Gene ID (NCBI): 3553 ENSEMBL Gene ID: ENSG00000125538 RRID: AB_3086272 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P01584 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924