Iright
BRAND / VENDOR: Proteintech

Proteintech, 30240-1-AP, SHISA8 Polyclonal antibody

CATALOG NUMBER: 30240-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SHISA8 (30240-1-AP) by Proteintech is a Polyclonal antibody targeting SHISA8 in IHC, ELISA applications with reactivity to Human samples 30240-1-AP targets SHISA8 in IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive IHC detected in: human lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The least studied AMPAR-interacting member of the Shisa protein family is SHISA8 (CKAMP39). In HEK293 cells, SHISA8 significantly affected AMPAR-mediated current kinetics, such as current amplitude, as well as AMPAR desensitization and recovery from desensitization (PMID:33892364). Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31420 Product name: Recombinant human SHISA8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 160-300 aa of NM_001353438 Sequence: RLGLERAHSPRARRTVTRALTELLKQPGPQEPLPPTLGPPLGGCVQVQMGDGLPRGSPHNSADKKRLNNAPRGSAAPGPPRGPRLQGGGSLTLQPDYAKYATFKAAALKAAEAAPRDFCQRFPALEPSPRQPPARAPRPSP Predict reactive species Full Name: transmembrane protein 46-like Calculated Molecular Weight: 42KD GenBank Accession Number: NM_001353438 Gene Symbol: SHISA8 Gene ID (NCBI): 440829 RRID: AB_3086274 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: B8ZZ34 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924