Proteintech, 30249-1-AP, Selenoprotein P Polyclonal antibody

Size: 20ul / 150ul The Selenoprotein P (30249-1-AP) by Proteintech is a Polyclonal antibody targeting Selenoprotein P in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 30249-1-AP targets Selenoprotein P in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Selenoprotein P, also known as SEPP1, is expressed in the liver and heart and secreted into the plasma(PMID: 8421687). Selenoprotein P is implicated as an extracellular antioxidant involved in the transport of selenium to extra-hepatic tissues via apolipoprotein E receptor-2 (apoER2) and provides selenium to tissues such as brain and testis. In humans, it exists in plasma as two isoforms of approximately 50 and 60 kDa(PMID:19453253). Selenoprotein P is a glycosylated protein and deglycosylation of SEPP1 results in 45 kDa and 35 kDa isoforms(PMID: 25298198). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32952 Product name: Recombinant human Selenoprotein P protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 82-299 aa of NM_001085486.2 Sequence: SNISYIVVNHQGISSRLKYTHLKNKVSEHIPVYQQEENQTDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTLKDEDFCKRVSLATVDKTVETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQKKLCRKRCINQLLCKLPTDSELAPRS Predict reactive species Full Name: selenoprotein P, plasma, 1 Calculated Molecular Weight: 43 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: NM_001085486.2 Gene Symbol: Selenoprotein P Gene ID (NCBI): 6414 RRID: AB_3086280 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P49908 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.