Iright
BRAND / VENDOR: Proteintech

Proteintech, 30254-1-AP, BLM Polyclonal antibody

CATALOG NUMBER: 30254-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The BLM (30254-1-AP) by Proteintech is a Polyclonal antibody targeting BLM in WB, ELISA applications with reactivity to human, mouse samples 30254-1-AP targets BLM in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: NIH/3T3 cells, HEK-293T cells, HeLa cells, Jurkat cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information BLM participates in DNA replication and repair, it is involved in 5'-end resection of DNA during double-strand break (DSB) repair. BLM can also be recruited by the KHDC3L-OOEP scaffold to DNA replication forks where it is retained by TRIM25 ubiquitination, it thereby promotes the restart of stalled replication forks. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32996 Product name: Recombinant human BLM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1235-1417 aa of Sequence: VHYFNIFNTVTLKKLAESLSSDPEVLLQIDGVTEDKLEKYGAEVISVLQKYSEWTSPAEDSSPGISLSSSRGPGRSAAEELDEEIPVSSHYFASKTRNERKRKKMPASQRSKRRKTASSGSKAKGGSATCRKISSKTKSSSIIGSSSASHTSQATSGANSKLGIMAPPKPINRPFLKPSYAFS Predict reactive species Full Name: Bloom syndrome, RecQ helicase-like Calculated Molecular Weight: 159 kDa Observed Molecular Weight: 160-175 kDa Gene Symbol: BLM Gene ID (NCBI): 641 RRID: AB_3086282 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P54132 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924