Iright
BRAND / VENDOR: Proteintech

Proteintech, 30296-1-AP, CCBL1 Polyclonal antibody

CATALOG NUMBER: 30296-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CCBL1 (30296-1-AP) by Proteintech is a Polyclonal antibody targeting CCBL1 in WB, IF/ICC, ELISA applications with reactivity to human samples 30296-1-AP targets CCBL1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, U-87 MG cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information CCBL1 encodes kynurenine aminotransferase 1 (KAT1), a key enzyme involved in kynurenine pathway. CCBL1 catalyzes the production of kynurenic acid, a powerful endogenous excitatory amino acid receptor antagonist that is widely regarded as the potent neuroprotective agent. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32316 Product name: Recombinant human CCBL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 201-374 aa of BC033685 Sequence: ATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRKMPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKVELWP Predict reactive species Full Name: cysteine conjugate-beta lyase, cytoplasmic Observed Molecular Weight: 48 kDa GenBank Accession Number: BC033685 Gene Symbol: CCBL1 Gene ID (NCBI): 883 RRID: AB_2935538 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16773 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924