Proteintech, 30297-1-AP, FLT3 Polyclonal antibody

Size: 20ul / 150ul The FLT3 (30297-1-AP) by Proteintech is a Polyclonal antibody targeting FLT3 in WB, IF/ICC, IP, ELISA applications with reactivity to human samples 30297-1-AP targets FLT3 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: THP-1 cells Positive IP detected in: THP-1 cells Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information FLT3 (also known as CD135 or FLK2) is a tyrosine-protein kinase that acts as a cell-surface receptor for the cytokine FLT3LG and regulates differentiation, proliferation, and survival of hematopoietic progenitor cells and of dendritic cells. FLT3 was originally identified by its expression in hematopoietic stem/progenitor cells (PMID: 7507245). It is important for the normal development of hematopoietic stem/progenitor cells. Mutations that result in the constitutive activation of this receptor result in acute myeloid leukemia and acute lymphoblastic leukemia. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32898 Product name: Recombinant human FLT3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 683-810 aa of BC126350 Sequence: LSGPIYLIFEYCCYGDLLNYLRSKREKFHRTWTEIFKEHNFSFYPTFQSHPNSSMPGSREVQIHPDSDQISGLHGNSFHSEDEIEYENQKRLEEEEDLNVLTFEDLLCFAYQVAKGMEFLEFKSCVHR Predict reactive species Full Name: fms-related tyrosine kinase 3 Calculated Molecular Weight: 112 kDa Observed Molecular Weight: 130 kDa, 150 kDa GenBank Accession Number: BC126350 Gene Symbol: FLT3 Gene ID (NCBI): 2322 RRID: AB_3086289 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P36888 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.