Iright
BRAND / VENDOR: Proteintech

Proteintech, 30328-1-AP, SCAMP5 Polyclonal antibody

CATALOG NUMBER: 30328-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SCAMP5 (30328-1-AP) by Proteintech is a Polyclonal antibody targeting SCAMP5 in WB, ELISA applications with reactivity to Human, mouse samples 30328-1-AP targets SCAMP5 in WB, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse brain tissue (incubated at 37°C) Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information Secretory carrier-associated membrane protein 5 (SCAMP5) belongs to the to the SCAMP family. Secretory carrier membrane proteins (SCAMPs) constitute a group of membrane transport proteins in plants, insects and mammals. The mammalian genome contains five types of SCAMP genes, namely, SCAMP1-SCAMP5. (PMID:36217917, PMID:19234194). SCAMPs participate in the vesicle cycling fusion of vesicles and cell membranes and play roles in regulating exocytosis and endocytosis, activating synaptic function and transmitting nerve signals. Among these proteins, SCAMP5 is highly expressed in the brain and has direct or indirect effects on the function of the central nervous system (PMID:36217917). SCAMP5 regulates membrane transport, controls the exocytosis of synaptic vesicles and is related to secretion carrier and membrane function. In addition, SCAMP5 plays a major role in the normal maintenance of the physiological functions of nerve cells (PMID:36217917, PMID:33663553). For optimal WB detection of this membrane protein, we recommend to avoid boiling the sample after lysis. Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31837 Product name: Recombinant human SCAMP5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 170-235 aa of BC024700 Sequence: SMVHKFYRGSGGSFSKAQEEWTTGAWKNPHVQQAAQNAAMGAAQGAMNQPQTQYSATPNYTYSNEM Predict reactive species Full Name: secretory carrier membrane protein 5 Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 26 kDa GenBank Accession Number: BC024700 Gene Symbol: SCAMP5 Gene ID (NCBI): 192683 RRID: AB_3086295 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TAC9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924