Proteintech, 30333-1-AP, FGF2 Polyclonal antibody

Size: 20ul / 150ul The FGF2 (30333-1-AP) by Proteintech is a Polyclonal antibody targeting FGF2 in WB, IF/ICC, ELISA applications with reactivity to human samples 30333-1-AP targets FGF2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, SKOV-3 cells, U-87 MG cells Positive IF/ICC detected in: SKOV-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Fibroblast growth factor-2 (FGF-2), also referred to as basic FGF, belongs to a family of growth factors that stimulate proliferation of cells of mesenchymal, epithelial and neuroectodermal origin. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in at least five different isoforms with distinct properties. Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28653 Product name: Recombinant human FGF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 143-275 aa of NM_002006 Sequence: MPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPG Predict reactive species Full Name: fibroblast growth factor 2 (basic) Calculated Molecular Weight: 31 aa Observed Molecular Weight: 21 kDa, 23 kDa GenBank Accession Number: NM_002006 Gene Symbol: FGF2 Gene ID (NCBI): 2247 RRID: AB_3669711 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P09038 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.