Proteintech, 30334-1-AP, ATPAF2 Polyclonal antibody

Size: 20ul / 150ul The ATPAF2 (30334-1-AP) by Proteintech is a Polyclonal antibody targeting ATPAF2 in WB, IHC, ELISA applications with reactivity to human, mouse samples 30334-1-AP targets ATPAF2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ATP synthase mitochondrial F1 complex assembly factor 2 (ATPAF2) also name as ATP12 and ATP12p, is an essential house keeping protein. ATPAF2 is an assembly factor for the F1 component of mitochondrial ATP synthase. This protein binds specifically to the F1 alpha subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly. The calculated MW is 33 kDa, 30334-1-AP can detect bands around 30 kDa and 50 kDa, the larger band may correspond to dimer or complex form. (PMID: 1826907, 11410595) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33299 Product name: Recombinant human ATPAF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 92-190 aa of BC032126 Sequence: TEWDSQQDTIKYYTMHLTTLCNTSLDNPTQRNKDQLIRAAVKFLDTDTICYRVEEPETLVELQRNEWDPIIEWAEKRYGVEISSSTSIMGPSIPAKTRE Predict reactive species Full Name: ATP synthase mitochondrial F1 complex assembly factor 2 Calculated Molecular Weight: 289 aa, 33 kDa Observed Molecular Weight: ~30 kDa GenBank Accession Number: BC032126 Gene Symbol: ATPAF2 Gene ID (NCBI): 91647 RRID: AB_3086297 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N5M1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.