Iright
BRAND / VENDOR: Proteintech

Proteintech, 30354-1-AP, GSDMA Polyclonal antibody

CATALOG NUMBER: 30354-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GSDMA (30354-1-AP) by Proteintech is a Polyclonal antibody targeting GSDMA in WB, ELISA applications with reactivity to Human, mouse samples 30354-1-AP targets GSDMA in WB, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: COLO 320 cells, Daudi cells, mouse stomach tissue, mouse skin tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:14000 Background Information Gasdermins, a family of five pore-forming proteins (GSDMA-GSDME) in humans expressed predominantly in the skin, mucosa and immune sentinel cells, are key executioners of inflammatory cell death (pyroptosis), which recruits immune cells to infection sites and promotes protective immunity. GSDMA was predicted to enable phosphatidylinositol-4,5-bisphosphate binding activity, phosphatidylinositol-4-phosphate binding activity, and phosphatidylserine binding activity. Involved in apoptotic process. Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31284 Product name: Recombinant human GSDMA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 232-445 aa of BC109197 Sequence: PPGEKSGEEKVILIQASDVGDVHEGFRTLKEEVQRETQQVEKLSRVGQSSLLSSLSKLLGKKKELQDLELALEGALDKGHEVNLEALPKDVLLSKEAVGAILYFVGALTELSEAQQKLLVKSMEKKILPVQLKLVESTMEQNFLLDKEGVFPLQPELLSSLGDEELTLTEALVGLSGLEVQRSGPQYMWDPDTLPRLCALYAGLSLLQQLTKAS Predict reactive species Full Name: gasdermin A Calculated Molecular Weight: 445 aa, 49 kDa Observed Molecular Weight: 49 kDa GenBank Accession Number: BC109197 Gene Symbol: GSDMA Gene ID (NCBI): 284110 RRID: AB_3086299 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96QA5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924