Proteintech, 30388-1-AP, GPX4 Polyclonal antibody

Size: 20ul / 150ul The GPX4 (30388-1-AP) by Proteintech is a Polyclonal antibody targeting GPX4 in WB, IF-P, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 30388-1-AP targets GPX4 in WB, IHC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HCT 116 cells, HL-60 cells, HEK-293 cells, Jurkat cells, mouse brain tissue, rat brain tissue Positive IP detected in: rat testis tissue Positive IF-P detected in: rat testis tissue Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information GPX4 (Phospholipid hydroperoxide glutathione peroxidase, mitochondrial) protects cells against membrane lipid peroxidation and cell death. Required for normal sperm development and male fertility.It has two isforms about 20KDa and 22KDa, respectively. GPX4 is a monomer,but it has a tendency to form higher mass oligomers (PMID:17630701). It presents primarily in testis. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, sheep Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30650 Product name: Recombinant human GPX4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 107-197 aa of BC021567 Sequence: KQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF Predict reactive species Full Name: glutathione peroxidase 4 (phospholipid hydroperoxidase) Observed Molecular Weight: 18-23 kDa GenBank Accession Number: BC021567 Gene Symbol: GPX4 Gene ID (NCBI): 2879 RRID: AB_3086304 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P36969 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.