Proteintech, 30400-1-AP, TLR4 Polyclonal antibody

Size: 20ul / 150ul The TLR4 (30400-1-AP) by Proteintech is a Polyclonal antibody targeting TLR4 in WB, ELISA applications with reactivity to human, mouse, rat samples 30400-1-AP targets TLR4 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: J774A.1 cells, THP-1 cells, RAW 264.7 cells, mouse liver tissue, mouse spleen tissue, rat liver tissue, rat spleen tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information TLR4, also known as CD284, belongs to the Toll-like receptor family. It is a type I transmembrane protein consisting of an extracellular leucine-rich repeat region, a helix transmembrane domain, and an intracellular Toll-IL-1 receptor domain. TLR4 functions as a pattern recognition receptor recognizing pathogen- and damage-associated molecular patterns (PAMPs and DAMPs) to induce innate immune responses via downstream signaling pathways. It interacts with LY96 and CD14 to mediate the innate immune response to bacterial lipopolysaccharide (LPS). TLR4 acts via MYD88, TIRAP, and TRAF6, leading to NF-kB activation, cytokine secretion, and the inflammatory response. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32998 Product name: Recombinant mouse Tlr4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 198-395 aa of NM_021297 Sequence: RENPQVNLSLDMSLNPIDFIQDQAFQGIKLHELTLRGNFNSSNIMKTCLQNLAGLHVHRLILGEFKDERNLEIFEPSIMEGLCDVTIDEFRLTYTNDFSDDIVKFHCLANVSAMSLAGVSIKYLEDVPKHFKWQSLSIIRCQLKQFPTLDLPFLKSLTLTMNKGSISFKKVALPSLSYLDLSRNALSFSGCCSYSDLG Predict reactive species Full Name: toll-like receptor 4 Calculated Molecular Weight: 96 kDa Observed Molecular Weight: 95-100 kDa GenBank Accession Number: NM_021297 Gene Symbol: Tlr4 Gene ID (NCBI): 21898 RRID: AB_3086308 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9QUK6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.