Proteintech, 30420-1-AP, CCR2 Polyclonal antibody

Size: 20ul / 150ul The CCR2 (30420-1-AP) by Proteintech is a Polyclonal antibody targeting CCR2 in WB, IF/ICC, ELISA applications with reactivity to human samples 30420-1-AP targets CCR2 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HaCaT cells, K-562 cells, THP-1 cells Positive IF/ICC detected in: THP-1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information CCR2 (C-C motif chemokine receptor-2), is a 42-kDa transmembrane protein highly expressed in bone marrow and lymph nodes (PMID: 16150057). It belongs to the G-protein-coupled seven-transmembrane receptor superfamily. CCR2 is the key functional receptor for MCP-1 (Monocyte chemoattractant protein-1) (PMID: 8146186). CCR2 and monocyte chemoattractant proteins (MCPs) play pivotal roles in the development of inflammatory responses and are crucial for the recruitment of immune cells to sites of inflammation. (PMID: 19441905). This antibody recognizes a homodimer consisting of its isoform1 and isoform2 (70 kDa). Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33071 Product name: Recombinant human CCR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-42 aa of BC074751 Sequence: MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGA Predict reactive species Full Name: chemokine (C-C motif) receptor 2 Calculated Molecular Weight: 374 aa, 42 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC074751 Gene Symbol: CCR2 Gene ID (NCBI): 729230 RRID: AB_3669721 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P41597 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.