Proteintech, 30440-1-AP, USP6NL Polyclonal antibody

Size: 20ul / 150ul The USP6NL (30440-1-AP) by Proteintech is a Polyclonal antibody targeting USP6NL in WB, IHC, ELISA applications with reactivity to human samples 30440-1-AP targets USP6NL in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HT-29 cells, HeLa cells, SW480 cells, Jurkat cells Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information USP6NL, also named RN-tre, is a GTPase-activating protein (GAP), which stimulates GTP hydrolysis on various members of the Rab family, thereby inhibiting endocytosis of PM receptors and retrograde Golgi transport. It is highly expressed in many cancer types and may promote the growth and proliferation of cancer cells. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32603 Product name: Recombinant human USP6NL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-160 aa of BC042943 Sequence: MNSDQDVALKLAQERAEIVAKYDRGREGAEIEPWEDADYLVYKVTDRFGFLHEEELPDHNVAVERQKHLEIERTTKWLKMLKGWEKYKNTEKFHRRIYKGIPLQLRGEVWALLLEIPKMKEETRDLYSKLKHRARGCSPDIRQIDLDVNRTFRDHIMFRD Predict reactive species Full Name: USP6 N-terminal like Calculated Molecular Weight: 828 aa, 94 kDa Observed Molecular Weight: 94 kDa GenBank Accession Number: BC042943 Gene Symbol: USP6NL Gene ID (NCBI): 9712 RRID: AB_3086315 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92738 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.