Iright
BRAND / VENDOR: Proteintech

Proteintech, 30443-1-AP, SYNCRIP Polyclonal antibody

CATALOG NUMBER: 30443-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SYNCRIP (30443-1-AP) by Proteintech is a Polyclonal antibody targeting SYNCRIP in WB, IF/ICC, ELISA applications with reactivity to Human samples 30443-1-AP targets SYNCRIP in WB, IF/ICC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: K-562 cells, THP-1 cells Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Synaptotagmin-binding, cytoplasmic RNA-interacting protein(SYNCRIP), also identified as hnRNP Q, involves in mRNA processing mechanisms. It's component of the CRD-mediated complex that promotes MYC mRNA stability. Also it is part of the APOB mRNA editosome complex and may modulate the postranscriptional C to U RNA-editing of the APOB mRNA through either by binding to A1CF (APOBEC1 complementation factor), to APOBEC1 or to RNA itself. May be involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. Interacts in vitro preferentially with poly(A) and poly(U) RNA sequences. As previously reported, the 65 and 74 kDa proteins corresponded to two isoforms of SYNCRIP produced from alternatively spliced mRNAs (PMID: 15340051). Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31509 Product name: Recombinant human SYNCRIP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 382-527 aa of BC032643 Sequence: KAQRQAAKNQMYDDYYYYGPPHMPPPTRGRGRGGRGGYGYPPDYYGYEDYYDYYGYDYHNYRGGYEDPYYGYEDFQVGARGRGGRGARGAAPSRGRGAAPPRGRAGYSQRGGPGSARGVRGARGGAQQQRGRGQGKGVEAGPDLLQ Predict reactive species Full Name: synaptotagmin binding, cytoplasmic RNA interacting protein Calculated Molecular Weight: 623 aa, 70 kDa Observed Molecular Weight: 62-74 kDa GenBank Accession Number: BC032643 Gene Symbol: SYNCRIP Gene ID (NCBI): 10492 RRID: AB_3086317 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60506 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924